PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4KG066600.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 186aa    MW: 21650.1 Da    PI: 9.531
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4KG066600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.74.3e-30959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krienk+ rqvtf+kRrng+lKKA+ELSvLCdaeva+iifss+g+l+e+s+
  Pavir.4KG066600.2.p  9 KRIENKISRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGRLFEFST 59
                         79***********************************************96 PP

2K-box98.97.5e-33861721399
                K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                           + + +qe+ kLk +ie Lq++qR+llGedL++Ls+keL+qLe+q+e slk+iRs Kn+ +l+q+ el++ke++lq+ nk+Lr+k++
  Pavir.4KG066600.2.p  86 AELNNYQEYLKLKTRIEFLQTTQRNLLGEDLGPLSIKELEQLENQIEISLKHIRSSKNQQMLDQLFELKRKEQQLQDSNKDLRRKVA 172
                          455789*******************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.207161IPR002100Transcription factor, MADS-box
CDDcd002652.25E-40278No hitNo description
SuperFamilySSF554559.94E-32275IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-32323IPR002100Transcription factor, MADS-box
PfamPF003199.5E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-323859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129715.52187177IPR002487Transcription factor, K-box
PfamPF014862.8E-2888171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MGRGKVELKR IENKISRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSS RGRLFEFSTS  60
SCMYKTLERY RICNFASEAS SAPIEAELNN YQEYLKLKTR IEFLQTTQRN LLGEDLGPLS  120
IKELEQLENQ IEISLKHIRS SKNQQMLDQL FELKRKEQQL QDSNKDLRRK VAHYVCVISL  180
VYYVC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A6e-26791739103Developmental protein SEPALLATA 3
4ox0_B6e-26791739103Developmental protein SEPALLATA 3
4ox0_C6e-26791739103Developmental protein SEPALLATA 3
4ox0_D6e-26791739103Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6616030.0JN661603.1 Setaria italica MADS5-like protein (OSM5) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964768.11e-116PREDICTED: MADS-box transcription factor 5-like
SwissprotA2Y9P01e-104MADS5_ORYSI; MADS-box transcription factor 5
SwissprotQ0DEB81e-104MADS5_ORYSJ; MADS-box transcription factor 5
TrEMBLK3XZ681e-116K3XZ68_SETIT; Uncharacterized protein
STRINGSi007226m1e-116(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.15e-72MIKC_MADS family protein